PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10003940
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 297aa    MW: 32956.8 Da    PI: 9.9407
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10003940genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF71.57.3e-233883146
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                 k++en+  r+vtfskR+ng++KKA ELS+LC+a+vavi+fs++ k+
  Lus10003940 38 KKVENDPHRHVTFSKRKNGLFKKATELSTLCGAQVAVILFSQHHKV 83
                 6789*************************************99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.2453090IPR002100Transcription factor, MADS-box
SMARTSM004325.5E-313089IPR002100Transcription factor, MADS-box
CDDcd002656.64E-333198No hitNo description
SuperFamilySSF554556.15E-2631100IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-193252IPR002100Transcription factor, MADS-box
PfamPF003192.4E-223985IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-195267IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-196788IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MTSGARTTAA GKKSKPEASA AAAAMKKPSK GRQKIEIKKV ENDPHRHVTF SKRKNGLFKK  60
ATELSTLCGA QVAVILFSQH HKVFSCGRPD VDSVLHRYDL HRLRESQIPN LTLNNDVNYG  120
DCKGSFGIGS ESAVQEQEYV RAVERLEEGK RYVAEMAALG GDPAAAGFWW ENWAVEKMEE  180
KDEVQSYKDS LVELREKVSA RIDSMTAESG GVRNNVTDFN LNWRNDPIAR ENPLVLRKSR  240
TGGVVRGSAP PMQWIAAAVP MIISMCYVLW LVFFVSSRSI GHGFLFVTKI MALQLR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A2e-153198168Myocyte-specific enhancer factor 2A
3mu6_B2e-153198168Myocyte-specific enhancer factor 2A
3mu6_C2e-153198168Myocyte-specific enhancer factor 2A
3mu6_D2e-153198168Myocyte-specific enhancer factor 2A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.18e-24AGAMOUS-like 62